PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014738m
Common NameEUTSA_v10014726mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 195aa    MW: 21512.6 Da    PI: 8.465
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014738mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.81.6e-24959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienks rqvtfskRrng++ KA  LSvLCda va++++s +gkly +ss
  Thhalv10014738m  9 KRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSS 59
                     79***********************************************96 PP

2K-box36.42.1e-13941623199
            K-box  31 LqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                      L+    +l+  ++++ s+  L qLe++Le++l+  R++K+el+l+ ++ l++kek l++en+ L +++e
  Thhalv10014738m  94 LELVESQLVDSSVDNASVDSLAQLEDHLETALSVTRARKTELMLKLVDSLKEKEKLLKRENQVLASQME 162
                      55555677778889999***********************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.955161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-35160IPR002100Transcription factor, MADS-box
CDDcd002652.92E-37278No hitNo description
SuperFamilySSF554553.27E-28275IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.60177167IPR002487Transcription factor, K-box
PfamPF014866.1E-1090161IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0042752Biological Processregulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0043234Cellular Componentprotein complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGRKKLEIKR IENKSSRQVT FSKRRNGLIE KARQLSVLCD ASVALLVVSA SGKLYSFSSG  60
DNLVKILDRY GKQHADDLKA LSKALSYGSH HELLELVESQ LVDSSVDNAS VDSLAQLEDH  120
LETALSVTRA RKTELMLKLV DSLKEKEKLL KRENQVLASQ MEKNQHVGAE ADNMEMSPGQ  180
ISDSNLPVTL PLLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-17283189Myocyte-specific enhancer factor 2A
3p57_I3e-17283189Myocyte-specific enhancer factor 2A
3p57_D3e-17283189Myocyte-specific enhancer factor 2A
3p57_C3e-17283189Myocyte-specific enhancer factor 2A
3p57_B3e-17283189Myocyte-specific enhancer factor 2A
3p57_A3e-17283189Myocyte-specific enhancer factor 2A
3kov_J3e-17283189Myocyte-specific enhancer factor 2A
3kov_I3e-17283189Myocyte-specific enhancer factor 2A
3kov_B3e-17283189Myocyte-specific enhancer factor 2A
3kov_A3e-17283189Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00079ChIP-seqTransfer from AT5G10140Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9575370.0AY957537.1 Thellungiella halophila flowering locus C (FLC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399504.11e-137hypothetical protein EUTSA_v10014726mg
SwissprotQ9S7Q71e-108FLC_ARATH; MADS-box protein FLOWERING LOCUS C
TrEMBLV4LEV81e-137V4LEV8_EUTSA; Uncharacterized protein
STRINGAT5G10140.11e-105(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.12e-98MIKC_MADS family protein